DOG-1 / ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody
Product Sizes
100 ug
£671.00
55107-MSM3-P1ABX-100UG
About this Product
- SKU:
- 55107-MSM3-P1ABX
- Additional Names:
- Discovered on gastrointestinal stromal tumors protein 1 | Oral cancer overexpressed protein 2 | Transmembrane protein 16A | Tumor-amplified and overexpressed sequence 2
- Application:
- Immunohistochemistry
- translate.label.attr.clone:
- DG1/447 + DOG-1.1
- Clonality:
- Monoclonal
- Extra Details:
- Expression of DOG-1 protein is elevated in the gastrointestinal stromal tumors (GIST's); c-kit signaling-driven mesenchymal tumors of the GI tract. DOG-1 is rarely expressed in other soft tissue tumors; which; due to appearance; may be difficult to diagnose. Immunoreactivity for DOG-1 has been reported in 97.8 percent of scorable GIST's; including all c-kit negative GIST's. Overexpression of DOG-1 has been suggested to aid in the identification of GISTs; including Platelet-Derived Growth Factor Receptor Alpha mutants that fail to express c-kit antigen. The overall sensitivity of DOG1 and c-kit in GIST's is nearly identical: 94.4% vs. 94.7%.
- Host:
- Mouse
- Immunogen:
- Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL); conjugated to a carrier protein (DOG-1.1).
- Isotype:
- IgG1
- Molecular Weight:
- ~114kDa
- Research Area:
- Infectious Disease; Neuroscience
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
- Supplier:
- NeoBiotechnologies
- Type:
- Antibodies: Monoclonal Antibody
- Manufacturer's Data Sheet:https://www.neobiotechnologies.com/download-datasheet/?PID=119880
