MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1) Antibody
Product Sizes
100 ug
£671.00
4214-MSM1-P1ABX-100UG
About this Product
- SKU:
- 4214-MSM1-P1ABX
- Additional Names:
- MAPK/ERK kinase kinase 1
- Application:
- Immunohistochemistry, Western Blot
- translate.label.attr.clone:
- 2F6
- Clonality:
- Monoclonal
- Extra Details:
- Mitogen-activated protein (MAP) kinase cascades are activated by various extracellular stimuli; including growth factors. The MEK kinases (also designated MAP kinase kinase kinases; MKKKs; MAP3Ks or MEKKs) phosphorylate and thereby activate the MEKs (also called MAP kinase kinases or MKKs); including ERK; JNK and p38. These activated MEKs in turn phosphorylate and activate the MAP kinases. The MEK kinases include Raf-1; Raf-B; Mos; MEK kinase-1; MEK kinase-2; MEK kinase-3; MEK kinase-4 and ASK 1 (MEK kinase- 5). MEK kinase-1 activates the ERK and c-Jun NH2-terminal kinase (JNK) pathways by phosphorylation of MAP2K1 and MAP2K4; and also activates the central protein kinases of the NFB pathway; CHUK and IKBKB. Additionally; MEK kinase-1 uses an E3 ligase through its PHD domain; a RING-finger-like structure; to target proteins for degradation through ubiquitination.
- Host:
- Mouse
- Immunogen:
- Partial recombinant MAP3K1 (aa1077-1176) (SKNSMTLDLNSSSKCDDSFGCSSNSSNAVIPSDETVFTP-VEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQK)
- Isotype:
- IgG2a
- Molecular Weight:
- 195kDa (intact); 80kDa (cleaved)
- Research Area:
- Cancer; Cardiovascular; Immunology; MAPK Signaling
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Antibody with azide - store at 2 to 8°C. Antibody without azide - store at -20 to -80°C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
- Supplier:
- NeoBiotechnologies
- Type:
- Antibodies: Monoclonal Antibody
- Manufacturer's Data Sheet:https://www.neobiotechnologies.com/download-datasheet/?PID=117871
