GDF9 (Growth Differentiation Factor 9) Antibody
Product Sizes
100 ug
£671.00
2661-MSM1-P1ABX-100UG
About this Product
- SKU:
- 2661-MSM1-P1ABX
- Application:
- ELISA, Immunohistochemistry, Western Blot
- translate.label.attr.clone:
- GDF9/4261
- Clonality:
- Monoclonal
- Extra Details:
- GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
- Host:
- Mouse
- Immunogen:
- Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
- Isotype:
- IgG1
- Molecular Weight:
- 51kDa
- Research Area:
- AKT Signaling
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Antibody with azide - store at 2 to 8 °C. Antibody without azide - store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
- Supplier:
- NeoBiotechnologies
- Type:
- Antibodies: Monoclonal Antibody
- Manufacturer's Data Sheet:https://www.neobiotechnologies.com/download-datasheet/?PID=114727
