GDF9 (Growth Differentiation Factor 9) Antibody

Product Sizes

20 ug

£364.00

2661-MSM1-P0-20UG

About this Product

SKU:: 2661-MSM1-P0
Application:: ELISA, Immunohistochemistry, Western Blot
translate.label.attr.clone:: GDF9/4261
Clonality:: Monoclonal
Extra Details:: GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
Host:: Mouse
Immunogen:: Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
Isotype:: IgG1
Molecular Weight:: 51kDa
Research Area:: AKT Signaling
Shipping Conditions:: Blue Ice
Storage Conditions:: Antibody with azide - store at 2 to 8 °C. Antibody without azide - store at -20 to -80 °C. Antibody is stable for 24 months. Non-hazardous. No MSDS required.
Supplier:: NeoBiotechnologies
Type:: Antibodies: Monoclonal Antibody

Basket