TLR4 antibody
Product Sizes
50 ug
£458.00
GTX31243-50UG
About this Product
- SKU:
- GTX31243
- Additional Names:
- toll like receptor 4 , ARMD10 , CD284 , TLR-4 , TOLL
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- PBS, 0.1% BSA, 0.1% Sodium azide.
- Clonality:
- Polyclonal
- Concentration:
- 1 mg/ml
- Extra Details:
- The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2012]
- Host:
- Goat
- Immunogen:
- Synthetic peptide LIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYC corresponding to amino acids 161-192 within the N-terminal region of Human TLR4.
- Isotype:
- IgG
- Physical State:
- Liquid
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted., -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- GeneTex
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:Download
