Human SARS coronavirus Spike glycoprotein protein
Product Sizes
20 ug
£502.00
ORB704564-20UG
100 ug
£864.00
ORB704564-100UG
1 mg
£2841.00
ORB704564-1MG
About this Product
- SKU:
- ORB704564
- Buffer:
- Lyophilized from Tris/PBS-based buffer; 6% Trehalose; pH 8.0
- Format:
- Lyophilized powder
- Purity:
- Greater than 85% as determined by SDS-PAGE.
- Sequence:
- RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
- Shipping Conditions:
- Blue Ice
- Source:
- Yeast
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules
