Human BTLA protein
Product Sizes
20 ug
£224.00
ORB624122-20UG
100 ug
£418.00
ORB624122-100UG
1 mg
£1894.00
ORB624122-1MG
About this Product
- SKU:
- ORB624122
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered PBS; 6% Trehalose; pH 7.4
- Format:
- Lyophilized powder
- Purity:
- Greater than 94% as determined by SDS-PAGE.
- Sequence:
- KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
- Shipping Conditions:
- Blue Ice
- Source:
- Mammalian cell
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules






