Rat Fgf2 protein
Product Sizes
10 ug
£288.00
ORB594771-10UG
50 ug
£660.00
ORB594771-50UG
500 ug
£2859.00
ORB594771-500UG
1 mg
£4047.00
ORB594771-1MG
About this Product
- SKU:
- ORB594771
- Buffer:
- Lyophilized from a 0.2 μm filtered 20 mM PB; 150 mM NaCl; pH 7.4
- Format:
- Lyophilized powder
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Sequence:
- ALPEDGGGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice
- Source:
- E.coli
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules


