Mouse Fgf2 protein
Product Sizes
10 ug
£186.00
ORB594760-10UG
50 ug
£344.00
ORB594760-50UG
500 ug
£1198.00
ORB594760-500UG
1 mg
£1681.00
ORB594760-1MG
About this Product
- SKU:
- ORB594760
- Buffer:
- Lyophilized from a 0.2 μm filtered solution of 20mM PB; 400mM NaCl; 0.02% Tween 80; 4.0% Sucrose; 4.0% Manntiol; pH 7.0
- Format:
- Lyophilized powder
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Sequence:
- MAASGITSLPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice
- Source:
- E.coli
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules
