Monkey IL1 alpha protein (Active)
Product Sizes
10 ug
£428.00
ORB358997-10UG
100 ug
£1783.00
ORB358997-100UG
500 ug
£3890.00
ORB358997-500UG
About this Product
- SKU:
- ORB358997
- Buffer:
- Lyophilized from a 0.2 µm filtered PBS; pH 7.4
- Format:
- Lyophilized powder
- Purity:
- > 97% as determined by SDS-PAGE and HPLC.
- Sequence:
- SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
- Shipping Conditions:
- Blue Ice
- Source:
- E.Coli
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules


