Recombinant Human Alpha-2-HS-glycoprotein (AHSG); partial (Active)
Product Sizes
100 mg
£465.00
ORB2657930-100MG
1 g
£1950.00
ORB2657930-1G
About this Product
- SKU:
- ORB2657930
- Buffer:
- Lyophilized from a 0.2 μm filtered solution containing 10 mM PB; pH 7.4
- Format:
- Lyophilized powder
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Sequence:
- TVVQPSVGAAAGPVVPPCPGRIRHFKV&APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCMVFQTQPVSSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVL
- Shipping Conditions:
- Blue Ice
- Source:
- Mammalian cell
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
