Recombinant Human Fibroblast growth factor 2 (FGF2) (Active)
Product Sizes
10 ug
£131.00
ORB2657917-10UG
50 ug
£186.00
ORB2657917-50UG
1 mg
£558.00
ORB2657917-1MG
About this Product
- SKU:
- ORB2657917
- Buffer:
- Lyophilized from a 0.2 μm filtered solution containing PBS; 5% mannitoland 0.01% Tween 80; pH 7.4
- Format:
- Lyophilized powder
- Purity:
- Greater than 95% as determined by SDS-PAGE.
- Sequence:
- PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice
- Source:
- E.coli
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
