E.coli IL1 alpha protein
Product Sizes
20 ug
£456.00
ORB246368-20UG
100 ug
£771.00
ORB246368-100UG
1 mg
£2386.00
ORB246368-1MG
About this Product
- SKU:
- ORB246368
- Buffer:
- If the delivery form is liquid; the default storage buffer is Tris/PBS-based buffer; 5%-50% glycerol. If the delivery form is lyophilized powder; the buffer before lyophilization is Tris/PBS-based buf
- Format:
- Liquid or Lyophilized powder
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Sequence:
- SAPFSFLSNMTYHFIRIIKHEFILNDTLNQTIIRANDQHLTAAAIHNLDEAVKFDMGAYTSSKDDTKVPVILRISKTQLYVSAQDEDQPVLLKEMPEINKTITGSETNFLFFWETHGTKNYFISVAHPNLFIATKHDNWVCLAKGLPSITDFQILENQA
- Shipping Conditions:
- Blue Ice
- Source:
- E.coli
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules


