Recombinant Human Monocarboxylate transporter 6 (SLC16A5)-VLPs
Product Sizes
20 ug
£678.00
ORB2280230-20UG
100 ug
£1263.00
ORB2280230-100UG
1 mg
£6293.00
ORB2280230-1MG
About this Product
- SKU:
- ORB2280230
- Buffer:
- Lyophilized powder
- Format:
- Lyophilized powder
- Purity:
- The purity information is not available for VLPs proteins.
- Sequence:
- MPQALERADGSWAWVVLLATMVTQGLTLGFPTCIGIFFTELQWEFQASNSETSWFPSILTAVLHMAGPLCSILVGRFGCRVTVMLGGVLASLGMVASSFSHNLSQLYFTAGFITGLGMCFSFQSSITVLGFYFVRRRVLANALASMGVSLGITLWPLLSRYLLENLGWRGTFLVFGGIFLHCCICGAIIRPVATSVAPETKECPPPPPETPALGCLAACGRTIQRHLAFDILRHNTGYCVYILGVMWSVLGFPLPQVFLVPYAMWHSVDEQQAALLISIIGFSNIFLRPLAGLMAGRPAFASHRKYLFSLALLLNGLTNLVCAASGDFWVLVGYCLAYSVSMSGIGALIFQVLMDIVPMDQFPRALGLFTVLDGLAFLISPPLAGLLLDATNNFSYVFYMSSFFLISAALFMGGSFYALQKKEQGKQAVAADALERDLFLEAKDGPGKQRSPEIMCQSSRQPRPAGVNKHLWGCPASSRTSHEWLLWPKAVLQAKQTALGWNSPT
- Shipping Conditions:
- Blue Ice
- Source:
- Mammalian cell
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins




