Recombinant Rat Lymphocyte antigen 6 complex locus protein G6d (Ly6g6d) (Active)
Product Sizes
20 ug
£381.00
ORB1785093-20UG
100 ug
£632.00
ORB1785093-100UG
1 mg
£2395.00
ORB1785093-1MG
About this Product
- SKU:
- ORB1785093
- Buffer:
- Lyophilized from a 0.2 μm sterile filtered 20 mM Tris-HCl; 0.5 M NaCl; 6% Trehalose; pH 8.0
- Format:
- Lyophilized powder
- Purity:
- Greater than 90% as determined by SDS-PAGE.
- Sequence:
- QRMRCYDCGGGPSNSCKQTVITCGEGERCGFLDRKPQPSSEQAKQPSATLSHHYPACVATHHCNQVAIESVGDVTFTTQKNCCFGDLCN
- Shipping Conditions:
- Blue Ice
- Source:
- Yeast
- Storage Conditions:
- The shelf life is related to many factors; storage state; buffer ingredients; storage temperature and the stability of the protein itself. Generally; the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
- Supplier:
- Biorbyt
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
