Ataxin 1 Antibody
Product Sizes
100ug
£593.00
OASE00303-100UG
About this Product
- SKU:
- OASE00303
- Additional Names:
- Ataxin-1; ATX1; Atxn1; D6S504E; OTTHUMP00000016065; SCA1; Spinocerebellar ataxia type 1 protein
- translate.label.attr.clone:
- S76-8
- Clonality:
- Monoclonal
- Conjugate:
- Unconjugated
- Concentration:
- 1 mg/ml
- Gene Details:
- ataxin 1
- Host:
- Mouse
- Immunogen:
- Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1. Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
- Isotype:
- IgG2b
- Purification:
- Protein G Purified
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store at -20C. Shipping with Blue Ice or 4C.
- Supplier:
- Aviva Systems Biology
- Type:
- Antibodies: Monoclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
