AMH Antibody
Product Sizes
0.1ml
£387.00
OASA00935-0.1ML
About this Product
- SKU:
- OASA00935
- Additional Names:
- MIF; MIS
- Clonality:
- Monoclonal
- Extra Details:
- AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kDa disulphide linked precursor that is cleaved to release the mature 30kDa homodimer.
- Host:
- Mouse
- Immunogen:
- Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
- Isotype:
- IgG1
- Protein Details:
- Muellerian-inhibiting factor
- Purification:
- Concentrated Tissue Culture Supernatant containing 0.1M Tris/HCl pH7.4 and 5-10% foetal calf serum.
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20Â[o]C
- Supplier:
- Aviva Systems Biology
- Type:
- Antibodies: Monoclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
