ADM2 Antibody
Product Sizes
25ul
£177.00
ARP64721-P050-25UL
100 ul
£412.00
ARP64721-P050-100UL
About this Product
- SKU:
- ARP64721-P050
- Additional Names:
- AM2; dJ579N16.4
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a protein which is a member of the calcitonin-related hormones. The encoded protein is involved in maintaining homeostasis in many tissues; acting via CRLR/RAMP receptor (calcitonin receptor-like receptor/receptor activity-modifying protein) complexes. Multiple alternatively spliced variants; encoding the same protein; have been identified.
- Gene Details:
- adrenomedullin 2
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence GPRRTQAQLLRVGCVLGTCQVQNLSHRLWQLMGPAGRQDSAPVDPSSPHS
- Molecular Weight:
- 16 kDa
- Protein Details:
- ADM2
- Purification:
- Affinity Purified
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Supplier:
- Aviva Systems Biology
- Type:
- Antibodies: Polyclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
