AICDA Antibody
Product Sizes
25ul
£177.00
ARP63254-P050-25UL
100 ul
£412.00
ARP63254-P050-100UL
About this Product
- SKU:
- ARP63254-P050
- Additional Names:
- AID; ARP2; CDA2; HIGM2; HEL-S-284
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation; gene conversion; and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2).
- Gene Details:
- activation-induced cytidine deaminase
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT
- Molecular Weight:
- 24 kDa
- Protein Details:
- Activation-induced cytidine deaminase
- Purification:
- Affinity Purified
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Supplier:
- Aviva Systems Biology
- Type:
- Antibodies: Polyclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
