LGR5 Antibody
Product Sizes
25ul
£177.00
ARP59640-P050-25UL
100 ul
£412.00
ARP59640-P050-100UL
About this Product
- SKU:
- ARP59640-P050
- Additional Names:
- FEX; HG38; GPR49; GPR67; GRP49
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Gene Details:
- leucine-rich repeat containing G protein-coupled receptor 5
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
- Molecular Weight:
- 100 kDa
- Protein Details:
- Leucine-rich repeat-containing G-protein coupled receptor 5
- Purification:
- Affinity Purified
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Supplier:
- Aviva Systems Biology
- Type:
- Antibodies: Polyclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
