AURKC Antibody
Product Sizes
25ul
£177.00
ARP53573-P050-25UL
100 ul
£412.00
ARP53573-P050-100UL
About this Product
- SKU:
- ARP53573-P050
- Additional Names:
- AIE2; AIK3; ARK3; AurC; SPGF5; STK13; HEL-S-90; aurora-C
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Extra Details:
- This gene encodes a member of the Aurora subfamily of serine/threonine protein kinases. The encoded protein is a chromosomal passenger protein that forms complexes with Aurora-B and inner centromere proteins and may play a role in organizing microtubules in relation to centrosome/spindle function during mitosis. This gene is overexpressed in several cancer cell lines; suggesting an involvement in oncogenic signal transduction. Alternative splicing results in multiple transcript variants.
- Gene Details:
- aurora kinase C
- Host:
- Rabbit
- Immunogen:
- The immunogen is a synthetic peptide directed towards the following sequence PRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGK
- Molecular Weight:
- 36 kDa
- Protein Details:
- Aurora kinase C
- Purification:
- Affinity Purified
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- For short term use; store at 2-8C up to 1 week. For long term storage; store at -20C in small aliquots to prevent freeze-thaw cycles.
- Supplier:
- Aviva Systems Biology
- Type:
- Antibodies: Polyclonal Antibody
- Manufacturer's Data Sheet:html_datasheet.php
