POMC polyclonal antibody
Product Sizes
100 ug
£562.00
PAB8938-100UG
About this Product
- SKU:
- PAB8938
- Application:
- Dot Blot, Immunohistochemistry, Immunoprecipitation, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against synthetic peptide of POMC.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to amino acids 138-176 of human POMC.
- Physical State:
- Liquid
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB8938
