ADM polyclonal antibody
Product Sizes
150 ug
£432.00
PAB4972-150UG
About this Product
- SKU:
- PAB4972
- Application:
- ELISA, Immunoprecipitation
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against synthetic peptide of ADM.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide (conjugated with KLH) corresponding to human ADM.
- Physical State:
- Liquid
- Reactivities:
- Human
- Sequence:
- YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB4972
