SARS-CoV S polyclonal antibody
Product Sizes
100 ug
£454.00
PAB31713-100UG
About this Product
- SKU:
- PAB31713
- Application:
- ELISA, Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against partial recombinant SARS-CoV S.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to amino acids 450-479 of SARS-CoV S.
- Isotype:
- IgG
- Physical State:
- Liquid
- Reactivities:
- Virus
- Sequence:
- PFERDISNVPFSPDGKPCTPPALNCYWPLN
- Shipping Conditions:
- Blue Ice
- Specificity:
- The antibody reacts with spike protein of SARS-CoV. Cross-reacts to most spike proteins from other subtypes of SARS-CoV.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB31713
