ABCB1 polyclonal antibody
Product Sizes
100 ug
£562.00
PAB29562-100UG
About this Product
- SKU:
- PAB29562
- Application:
- IHC-Frozen, IHC-Paraffin
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against partial synthetic protein of human ABCB1.
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to amino acids 621-650 at internal region of human ABCB1.
- Isotype:
- IgG
- Physical State:
- Lyophilized
- Reactivities:
- Human, Mouse, Rat
- Sequence:
- IYFKLVTMQTAGNEVELENAADESKSEIDA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Please refer to datasheet
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB29562
