C11orf60 polyclonal antibody
Product Sizes
100 ul
£697.00
PAB23184-100UL
About this Product
- SKU:
- PAB23184
- Application:
- IHC-Paraffin, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against recombinant C11orf60.
- Host:
- Rabbit
- Immunogen:
- Recombinant protein corresponding to amino acids of human C11orf60.
- Isotype:
- IgG
- Physical State:
- Liquid
- Reactivities:
- Human
- Sequence:
- ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles., -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB23184
