Ralgapa1 polyclonal antibody
Product Sizes
50 ug
£697.00
PAB15730-50UG
About this Product
- SKU:
- PAB15730
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against partial recombinant Ralgapa1.
- Host:
- Rabbit
- Immunogen:
- Recombinant GST fusion protein corresponding to 158 mouse Ralgapa1.
- Physical State:
- Liquid
- Reactivities:
- Mouse
- Sequence:
- MRPVDDPGVPSEWTSPASAGSSDLMSSDSHSDSFSAFQCEGRKFDNFGFGTDIGIPSSADVDLGSGHHQSTEEQEVASLTTLHLDSETSSLNQQAFSAEVATVTGSESASPVHSALGSRSQTPSPSTLSRAHIEQKDLQLDEKLHHSVLQTPDDLGNA
- Shipping Conditions:
- Blue Ice
- Specificity:
- Specific to recombinant protein GX0664. This antibody detects mGARNL1 protein.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB15730
