Pdcd11 polyclonal antibody
Product Sizes
50 ug
£697.00
PAB15709-50UG
About this Product
- SKU:
- PAB15709
- Application:
- Western Blot
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against partial recombinant Pdcd11.
- Host:
- Rabbit
- Immunogen:
- Recombinant GST fusion protein corresponding to a 170 amino acid fragment of mouse Pdcd11.
- Physical State:
- Liquid
- Reactivities:
- Human, Mouse
- Sequence:
- TKSEKYKEAGELYNRMLKRFRQEKAVWIKYGAFVLGRSQAGASHRVLQRALECLPAKEHVDVIVKFAQLEFQLGDVERAKAIFENTLSTYPKRTDVWSVYIDMTIKHGSQTAVRDIFERVIHLSLAPKRMKFFFKRYLDYEKQHGTEKDVQAVKAKALEYVEAKSSALED
- Shipping Conditions:
- Blue Ice
- Specificity:
- Specific to recombinant protein GX0685. This antibody detects mPDCD11 protein. It also recognizes human PDCD11 protein.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB15709
