Kcnd2 polyclonal antibody
Product Sizes
100 ug
£697.00
PAB15702-100UG
About this Product
- SKU:
- PAB15702
- Application:
- Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- Rabbit polyclonal antibody raised against partial recombinant Kcnd2 (Cerebellum, Granule cell).
- Host:
- Rabbit
- Immunogen:
- Recombinant GST fusion protein corresponding to 187 mouse Kcnd2.
- Physical State:
- Liquid
- Reactivities:
- Mouse
- Sequence:
- YMQSKRNGLLSNQLQSSEDEPAFISKSGSSFETQHHHLLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHRPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL
- Shipping Conditions:
- Blue Ice
- Specificity:
- Specific to recombinant protein GXD01. This antibody detects endogenous mKCND2 protein in cerebellar granule cells.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB15702
