Agrp polyclonal antibody
Product Sizes
50 ul
£562.00
PAB14305-50UL
About this Product
- SKU:
- PAB14305
- Application:
- IHC-Frozen, Immunofluorescence, Immunohistochemistry
- Clonality:
- Polyclonal
- Extra Details:
- Guinea pig polyclonal antibody raised against synthetic peptide of Agrp.
- Host:
- Guinea Pig
- Immunogen:
- A synthetic peptide (conjugated with carrier protein) corresponding to amino acids 82-131 of mouse Agrp.
- Physical State:
- Lyophilized
- Reactivities:
- Mouse, Sheep
- Sequence:
- SPRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTATNLCSRT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- 2-8[o]C Aliquot. Avoid freeze/thaw cycles. Desiccated., -20[o]C reconstituted. Aliquot. Avoid freeze/thaw cycles. Desiccated.
- Supplier:
- Abnova
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:PAB14305
