Atxn1 monoclonal antibody, clone S76-8 (HRP)
Product Sizes
100 ug
£836.00
MAB17080-100UG
About this Product
- SKU:
- MAB17080
- Application:
- IHC-Paraffin, Immunocytochemistry, Immunofluorescence, Immunoprecipitation, Western Blot
- translate.label.attr.clone:
- S76-8
- Clonality:
- Monoclonal
- Conjugate:
- HRP
- Extra Details:
- Mouse monoclonal antibody raised against synthetic peptide of mouse Atxn1.
- Host:
- Mouse
- Immunogen:
- A synthetic peptide corresponding to amino acids 164-197 of mouse Atxn1.
- Isotype:
- IgG2b
- Physical State:
- Liquid
- Reactivities:
- Human, Mouse
- Sequence:
- ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:MAB17080
