KIT monoclonal antibody
Product Sizes
25 ul
£432.00
MAB15539-25UL
100 ul
£562.00
MAB15539-100UL
About this Product
- SKU:
- MAB15539
- Application:
- IHC-Paraffin, Western Blot
- translate.label.attr.clone:
- CL1667
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against partial recombinant human KIT.
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to amino acids 50-190 of human KIT.
- Isotype:
- IgG2a
- Physical State:
- Liquid
- Reactivities:
- Human
- Sequence:
- VGDEIRLLCTDPGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLVDRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYHRLCLHCSVDQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:MAB15539
