Villin monoclonal antibody, clone VIL1/1314
Product Sizes
100 ug
£562.00
MAB15029-100UG
About this Product
- SKU:
- MAB15029
- Application:
- Flow Cytometry, IHC-Paraffin, Immunofluorescence, Western Blot
- translate.label.attr.clone:
- VIL1/1314
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against partial recombinant human Villin.
- Host:
- Mouse
- Immunogen:
- Recombinant protein corresponding to 133 residues of human Villin.
- Isotype:
- IgG1, kappa
- Physical State:
- Liquid
- Reactivities:
- Human
- Sequence:
- MGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALKLYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:MAB15029
