Apoa2 monoclonal antibody (M02), clone 3G3

Product Sizes

100 ug

£440.00

MAB10001-M02-100UG

About this Product

SKU:: MAB10001-M02
Application:: ELISA
translate.label.attr.clone:: 3G3
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant Apoa2.
Host:: Mouse
Immunogen:: Apoa2 (NP_038502, 24 a.a. ~ 102 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human, Mouse
Sequence:: QADGPDMQSLFTQYFQSMTEYGKDLVEKAKTSEIQSQVKAYFEKTHEQLTPLVRSAGTSLVNFFSSLMNLEEKPAPAAK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket