C9orf103 monoclonal antibody (M10), clone 3B7

Product Sizes

100 ug

£333.00

H00414328-M10-100UG

About this Product

SKU:: H00414328-M10
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3B7
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant C9orf103.
Host:: Mouse
Immunogen:: C9orf103 (NP_001001551, 41 a.a. ~ 141 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: KKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKMK
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket