ZNF181 monoclonal antibody (M01), clone 5F1

Product Sizes

100 ug

£333.00

H00339318-M01-100UG

About this Product

SKU:: H00339318-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 5F1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ZNF181.
Host:: Mouse
Immunogen:: ZNF181 (XP_290835, 354 a.a. ~ 461 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: FIHRSSLIHHQKIHTGEKPYECRECGKAFCCSSHLTRHQRIHTMEKQYECNKCLKVFSSLSFLVQHQSIHTEEKPFECQKCRKSFNQLESLNMHLRNHIRLKPYECSI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket