GATC monoclonal antibody (M01), clone 3G9

Product Sizes

100 ug

£333.00

H00283459-M01-100UG

About this Product

SKU:: H00283459-M01
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3G9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant GATC.
Host:: Mouse
Immunogen:: GATC (NP_789788.1, 1 a.a. ~ 136 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket