NPAS4 monoclonal antibody (M09), clone 4E4

Product Sizes

100 ug

£333.00

H00266743-M09-100UG

About this Product

SKU:: H00266743-M09
Application:: ELISA, Western Blot
translate.label.attr.clone:: 4E4
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant NPAS4.
Host:: Mouse
Immunogen:: NPAS4 (NP_849195.1, 704 a.a. ~ 802 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: FLEETPVEDIFMDLSTPDPSEEWGSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDELHQLQSQVQDSFHEDGSGGEPTF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket