IL27 monoclonal antibody (M03), clone 1A9

Product Sizes

100 ug

£333.00

H00246778-M03-100UG

About this Product

SKU:: H00246778-M03
Application:: ELISA, Western Blot
translate.label.attr.clone:: 1A9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant IL27.
Host:: Mouse
Immunogen:: IL27 (NP_663634, 177 a.a. ~ 243 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: RKGLLPGALGSALQGPAQVSWPQLLSTYRLLHSLELVLSRAVRELLLLSKAGHSVWPLGFPTLSPQP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket