SLC29A4 monoclonal antibody (M03), clone 6B6

Product Sizes

100 ug

£333.00

H00222962-M03-100UG

About this Product

SKU:: H00222962-M03
Application:: ELISA, Western Blot
translate.label.attr.clone:: 6B6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant SLC29A4.
Host:: Mouse
Immunogen:: SLC29A4 (NP_694979, 283 a.a. ~ 345 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Rat
Sequence:: VHHDVVAGDVHFEHPAPAPAPNESPKDSPAHEVTGSGGAYMRFDVPRPRVQRSWPTFRALLLH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket