ARL13B monoclonal antibody (M01A), clone 7G9

Product Sizes

200 ul

£333.00

H00200894-M01A-200UL

About this Product

SKU:: H00200894-M01A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 7G9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant ARL13B.
Host:: Mouse
Immunogen:: ARL13B (NP_878899.1, 329 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgM, kappa
Reactivities:: Human
Sequence:: KNEDETDRPSLESANGKKKTKKLRMKRNHRVEPLNIDDCAPESPTPPPPPPPVGWGTPKVTRLPKLEPLGETHHNDFYRKPLPPLAVPQRPNSDAHDVIS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket