CDC20B monoclonal antibody (M11), clone 2F2

Product Sizes

100 ug

£333.00

H00166979-M11-100UG

About this Product

SKU:: H00166979-M11
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 2F2
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant CDC20B.
Host:: Mouse
Immunogen:: CDC20B (NP_689836.2, 416 a.a. ~ 515 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: VLAIGGGMKDGRLHILDINAGKSIQTPSTNSQICSLIWLPKTKEIATGQGTPKNDVTVWTCPTVSRSGHRGRVLHLALSPDQTRVFSAAADGTASVWNCY
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket