DYX1C1 monoclonal antibody (M09), clone 6G1

Product Sizes

100 ug

£333.00

H00161582-M09-100UG

About this Product

SKU:: H00161582-M09
Application:: ELISA, Immunofluorescence, Immunoprecipitation, Western Blot
translate.label.attr.clone:: 6G1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant DYX1C1.
Host:: Mouse
Immunogen:: DYX1C1 (NP_570722, 336 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: KLKNLHKAIEDSSKALELLMPPVTDNANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket