C18orf23 monoclonal antibody (M01), clone 3A1

Product Sizes

100 ug

£333.00

H00147341-M01-100UG

About this Product

SKU:: H00147341-M01
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 3A1
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant C18orf23.
Host:: Mouse
Immunogen:: C18orf23 (NP_689683, 122 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Rat
Sequence:: VSHPRRSQERVSVHPHRLHPSFDFGQLQTPQPRYLAEGTDWDLSVDAGLSPAQFQVRPIPQHYQHYLATPRMHHFPRNSSSTQMVVHEIRNYPYPQLHF
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket