MESP2 monoclonal antibody (M03), clone 1E11

Product Sizes

100 ug

£333.00

H00145873-M03-100UG

About this Product

SKU:: H00145873-M03
Application:: ELISA
translate.label.attr.clone:: 1E11
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full length recombinant MESP2.
Host:: Mouse
Immunogen:: MESP2 (XP_085261, 2 a.a. ~ 125 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: AQSPPPQSLLGHDHWIFAQGWGWAGHWDSTSPASSSDSSGSCPCDGARGLPQPQPPSCSSRAAEAAATTPRRARTGPAGGQRQSASEREKLRMRTLARALHELRRFLPPSLAPAGQSLTKIETL*
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket