GSC monoclonal antibody (M10), clone 4B9

Product Sizes

100 ug

£333.00

H00145258-M10-100UG

About this Product

SKU:: H00145258-M10
Application:: ELISA, Immunofluorescence, Western Blot
translate.label.attr.clone:: 4B9
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant GSC.
Host:: Mouse
Immunogen:: GSC (NP_776248, 151 a.a. ~ 257 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: LLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSSKASPEKREEEGKSDLDSDS
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket