DYDC1 monoclonal antibody (M02), clone 2B8

Product Sizes

100 ug

£333.00

H00143241-M02-100UG

About this Product

SKU:: H00143241-M02
Application:: ELISA, Western Blot
translate.label.attr.clone:: 2B8
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a full-length recombinant DYDC1.
Host:: Mouse
Immunogen:: DYDC1 (AAH19250, 1 a.a. ~ 177 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG1, kappa
Reactivities:: Human
Sequence:: MESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTMEQLRQKEMAKLERERELALMEQEMMERLKAEELLLQQQQLALQLELEMQEKERQRIQELQRAQEQLGKEMRMNMENLVRNEDILHSEEATLDSGKTLAEISDRYGAPNLSRVEELDEPMFSDIALNIDQDL
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket