JMY monoclonal antibody (M05A), clone 5B6

Product Sizes

200 ul

£333.00

H00133746-M05A-200UL

About this Product

SKU:: H00133746-M05A
Application:: ELISA, Western Blot
translate.label.attr.clone:: 5B6
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant JMY.
Host:: Mouse
Immunogen:: JMY (NP_689618, 535 a.a. ~ 634 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human, Mouse
Sequence:: SPMDEVLASLKRGSFHLKKVEQRTLPPFPDEDDSNNILAQIRKGVKLKKVQKDVLRESFTLLPDTDPLTRSIHEALRRIKEASPESEDEEEALPCTDWEN
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket