RPL32P3 monoclonal antibody (M02), clone 1D5
Product Sizes
100 ug
£333.00
H00132241-M02-100UG
About this Product
- SKU:
- H00132241-M02
- Application:
- ELISA
- translate.label.attr.clone:
- 1D5
- Clonality:
- Monoclonal
- Extra Details:
- Mouse monoclonal antibody raised against a full-length recombinant RPL32P3.
- Host:
- Mouse
- Immunogen:
- RPL32P3 (AAH53996.1, 1 a.a. ~ 33 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Reactivities:
- Human
- Sequence:
- MAALRSLVKPKIVKKRTKKFIRHQSDRYVKIKR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- Abnova
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:H00132241-M02
