B3GALT6 monoclonal antibody (M06), clone 3E5

Product Sizes

100 ug

£333.00

H00126792-M06-100UG

About this Product

SKU:: H00126792-M06
Application:: ELISA, Western Blot
translate.label.attr.clone:: 3E5
Clonality:: Monoclonal
Extra Details:: Mouse monoclonal antibody raised against a partial recombinant B3GALT6.
Host:: Mouse
Immunogen:: B3GALT6 (NP_542172, 229 a.a. ~ 329 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Isotype:: IgG2a, kappa
Reactivities:: Human
Sequence:: RLSRDYLRAWHSEDVSLGAWLAPVDVQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKREVQLRLSYVYDWSAPPSQCCQRREGIP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: Abnova
Type:: Antibody: Monoclonal Antibody

Basket